Peptide Solubility
Explained

What is peptide solubility?

Peptide solubility is how much of a peptide dissolves in a given solvent, at a given pH and temperature, to give a clear solution with no particles. The sequence largely sets it, and a consensus paper on peptides used in mass spectrometry assays gives general rules (Hoofnagle et al., 2016).

This page covers how labs read a sequence to choose a solvent for a lyophilized peptide; the peptide reconstitution guide covers bench steps and concentration math. Disguised Alpha supplies Bacteriostatic Water 0.9% and Acetic Acid 0.6% as diluents, for laboratory research use only. Nothing on this page is guidance for use in people.

Estimate net charge from the sequence

Charge keeps peptide molecules apart in water, so start with a count near pH 7:

• +1 for each arginine (R) and lysine (K), and for a free N-terminal amine.
• -1 for each aspartate (D) and glutamate (E), and for a free C-terminal carboxyl.
• Histidine (H): +1 only in acid.
• Caps: C-terminal amidation removes the -1, and N-terminal acetylation or another acyl cap removes the +1 (see peptide modifications).

Measured pKa values in blocked alanine pentapeptides explain the count: 3.67 for Asp and the C-terminal carboxyl, 4.25 for Glu, 6.54 for His, 8.00 for the N-terminal amine and 10.40 for Lys (Thurlkill et al., 2006). A positive sum marks a basic peptide, a negative sum an acidic one.

In dilute acid, around pH 3, most carboxyl groups are protonated and neutral, so a basic peptide gains net positive charge. In dilute base, the N-terminal amine and histidine lose protons, so an acidic peptide gains net negative charge. Hence the consensus rule: acidic peptides dissolve best in basic solutions, basic peptides in acidic ones (Hoofnagle et al., 2016).

Hydrophobic peptide solubility and aggregation

When the net charge is near zero, hydrophobic content decides. In the consensus paper, peptides with under 25% charged residues dissolve best with some organic solvent added, and acetonitrile or DMF suits those that also have over 50% hydrophobic residues (Ala, Val, Leu, Ile, Met, Phe, Trp, Pro) (Hoofnagle et al., 2016). Hydrophobic stretches also drive aggregation as chains stack into intermolecular beta-sheets.

The TANGO algorithm, built on that mechanism, predicted aggregation across 179 published and 71 new peptides (Fernandez-Escamilla et al., 2004). CamSol-PTM predicts the intrinsic aqueous solubility of peptides from sequence, including those with modified residues, and was checked against 37 measured variants (Oeller et al., 2023). Hydrophobic peptides also stick to surfaces; in antibody digests, guanidine hydrochloride was critical to prevent their adsorptive loss (Kristensen et al., 2023).

The isoelectric point

The isoelectric point (pI) is the pH at which a peptide's positive and negative charges balance, giving zero net charge. With nothing to keep molecules apart, solubility is usually lowest there: synthetic amyloid-beta has a pI of about 5.5, where its precipitation and aggregation propensity are maximal (Fezoui et al., 2000).

The pI is calculated from the sequence with a set of pKa values, and the sets differ; the IPC calculator's optimized sets estimated peptide pI with an average error of 0.25 pH units (Kozlowski, 2016). Labs therefore pick a solvent pH well clear of the estimate: below it for a basic peptide, above it for an acidic one.

Worked example: tesamorelin

The tesamorelin research guide lists its 44 residues, YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with a trans-3-hexenoyl group on Tyr1 and a C-terminal amide. Both ends are capped, so only side chains count.

Tesamorelin is basic. With the pentapeptide pKa values and a typical arginine value, the calculated charge is about +7.5 at pH 3, with a pI of about 11 (calculated, not measured).

It is 27% charged and 34% hydrophobic by the consensus list, so it falls outside the consensus paper's groups for organic solvent (Hoofnagle et al., 2016), and its one methionine (Met27) is the residue type that paper flags for oxidation in DMSO. The tesamorelin gelling guide covers the gel it can form in plain water. By the same count, BPC-157 (GEPPPGKPADDAGLV, free ends) sums to about -2 at pH 7: an acidic peptide.

How to dissolve peptides: a common solvent order

Labs start with the mildest solvent and add strength only as needed:

1. Water, for any peptide with a clear net charge. Bacteriostatic water is not plain water: the certificate summarized on the Bacteriostatic Water 0.9% product page specifies benzyl alcohol at 0.8 to 1.0% and pH 4.5 to 7.0, so it is no substitute for the acid step.
2. Dilute acid for basic peptides. The Acetic Acid 0.6% product page describes an acidic diluent for protocols that call for one and says it is not interchangeable with BAC water, sterile water or saline. The consensus paper uses up to 1% formic acid or TFA (Hoofnagle et al., 2016).
3. Dilute base for acidic peptides: about 1% ammonium bicarbonate, or ammonium hydroxide (Hoofnagle et al., 2016). Avoided for cysteine peptides (see below).
4. Organic cosolvent for neutral or hydrophobic peptides: the smallest workable volume of DMSO, DMF or acetonitrile, then water or buffer added slowly while mixing. Peptides in neat DMSO may precipitate on dilution, and methionine may oxidize in DMSO (Hoofnagle et al., 2016).
5. Salts and buffers last, once the peptide is dissolved (see the reconstitution guide).

Each step has a cost. In antibody digests held at 5°C, 1% TFA (pH 0.5) caused significant acid-catalyzed deamidation within hours to days, while 1% formic acid (pH 2.3) caused almost none (Kristensen et al., 2023). Assays commonly carry 0.1 to 5% DMSO, and low amounts destabilized two proteins and changed one protein's apparent binding (Tjernberg et al., 2006), so assays need a matching vehicle control.

Test a small portion first

For an unfamiliar sequence, the consensus paper recommends dissolving a small weighed aliquot before committing the lot (Hoofnagle et al., 2016); if the test fails, the rest stays dry. Two common aids, both used briefly:

• Sonication. A short ultrasonic bath can break up particles, but sonication made a range of proteins form amyloid-like aggregates, including 5 to 20 nm fibrils, that seeded further aggregation in unsonicated solutions on heating (Stathopulos et al., 2004).
• Mild warming, a few degrees above room temperature. For amyloid-beta, temperature, time, concentration, pH and ionic strength together determined whether oligomers or fibrils formed (Stine et al., 2003).

A clear solution is the first check; light scattering, or absorbance across a dilution series with and without centrifugation, confirms dissolution (Hoofnagle et al., 2016).

Cysteine and methionine peptides

Free cysteine thiols oxidize to disulfides, linking chains. The reacting form is the thiolate anion, which grows as the pH nears the thiol pKa. In 16 model peptides, thiol pKa values ran from 7.4 to 9.1, and the pKa and nearby charges set exchange rates with disulfides (Bulaj et al., 1998). Labs keep cysteine peptides at acidic to neutral pH in degassed solvents.

In aqueous DMSO with hydrochloric acid, methionine oxidized to methionine sulfoxide in a strongly pH-dependent reaction, and free SH groups oxidized after a lag of about 2 hours (Shechter, 1986). Oxidation of a cysteine peptide also rose with DMSO concentration (Akimoto et al., 2020). DMF or acetonitrile are the usual alternatives.

Gelling and fibril formation

A gel is a network of peptide fibrils that traps the solvent. Some sequences assemble readily: a 16-residue peptide of repeating Ala, Glu and Lys gave a beta-sheet spectrum in water, and on adding salt formed a membrane of 10 to 20 nm filaments that heat, acid, alkali, guanidine hydrochloride and SDS with urea did not dissolve (Zhang et al., 1993).

Hence labs dissolve the peptide first and add salt last. Amyloid-beta precipitation and aggregation are maximal near its pI (Fezoui et al., 2000), and solubility is usually lowest at the pI, so a gelled or cloudy test portion calls for a different solvent or pH, not more mixing.

How counterions change apparent solubility

A lyophilized peptide is a salt, and the counterion changes how a sequence behaves. Amyloid-beta dissolved in sodium hydroxide and freeze-dried gave significantly higher yields of monomers and dimers than its trifluoroacetate (TFA) or hydrochloride salts, and in neutral buffer its pH moved from about 10.5 to neutral, avoiding the pI (Fezoui et al., 2000). Residual acid from purification can keep an unbuffered solution acidic; if a buffer then raises the pH toward the pI, a peptide that dissolved in water can come out of solution. The TFA vs acetate guide covers salt forms and how certificates report them.

Record what was done

Record enough to repeat the preparation: the lot number and its certificate from the COA portal, the amount used, each solvent in order with its volume, the final composition (such as percent DMSO), the pH if measured, sonication or warming times, and the appearance before and after centrifugation. Note failed attempts too.

Key sources

1. Hoofnagle AN, et al. "Recommendations for the Generation, Quantification, Storage, and Handling of Peptides Used for Mass Spectrometry-Based Assays." Clin Chem. 2016. PMID 26719571. DOI 10.1373/clinchem.2015.250563.
2. Thurlkill RL, et al. "pK values of the ionizable groups of proteins." Protein Sci. 2006. PMID 16597822. DOI 10.1110/ps.051840806.
3. Fezoui Y, et al. "An improved method of preparing the amyloid beta-protein for fibrillogenesis and neurotoxicity experiments." Amyloid. 2000. PMID 11019857. DOI 10.3109/13506120009146831.

Frequently asked questions

How do you dissolve peptides?

Labs count the net charge, then test a small weighed portion: water first, dilute acid for a basic peptide, dilute ammonium bicarbonate for an acidic one, and a minimal organic cosolvent for a hydrophobic one, with buffers added last.

What determines peptide solubility?

Net charge at the working pH, distance from the isoelectric point, hydrophobic content, concentration, temperature and the counterion. CamSol-PTM estimates it from sequence (Oeller et al., 2023).

What if a peptide won't dissolve?

Labs stop agitating and change one variable at a time: pH first, then a little organic cosolvent, with brief sonication or mild warming. Dissolution is confirmed by centrifugation, and each attempt is recorded.

Why use acetic acid for peptides?

Acid protonates Asp and Glu side chains, so a basic peptide gains positive charge and dissolves more readily. The Acetic Acid 0.6% page limits its use to compounds or protocols that call for an acidic diluent.

Can you dissolve peptides in DMSO?

Often, for hydrophobic sequences. But DMSO can oxidize methionine and cysteine (Shechter, 1986; Akimoto et al., 2020), stocks may precipitate on dilution, and assays need a vehicle control.

How are hydrophobic peptides dissolved?

In a little DMSO, DMF or acetonitrile first, then water added slowly. The consensus paper names acetonitrile or DMF for peptides over 50% hydrophobic and under 25% charged (Hoofnagle et al., 2016).

What is the isoelectric point of a peptide?

The pH at which its net charge is zero, where solubility is usually lowest. Calculators estimate it from the sequence and differ with their pKa sets (Kozlowski, 2016).

Related guides

• Peptide reconstitution guide
• TFA vs acetate peptide salts
• Tesamorelin gelling guide
• What does lyophilized mean?
• Bacteriostatic water vs sterile water
• Acetic Acid 0.6%
• Bacteriostatic Water 0.9%

Disguised Alpha products are for research use only. They have not been evaluated for safety or effectiveness in humans. Not for human consumption. All products are intended for laboratory research purposes only.